Anti CCZ1 pAb (ATL-HPA045114)

Atlas Antibodies

SKU: ATL-HPA045114-25

• 
• 

Protein Description: CCZ1 homolog, vacuolar protein trafficking and biogenesis associated
Gene Name: CCZ1
Alternative Gene Name: C7orf28A, CCZ1A, CGI-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029617: 95%, ENSRNOG00000001032: 95%
Entrez Gene ID: 51622
Uniprot ID: P86791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMPGNLQHYGRFLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCRRLDSIVGPQLTVLASDICEQFNINKRMSGSEK
• Gene Sequence: EMPGNLQHYGRFLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCRRLDSIVGPQLTVLASDICEQFNINKRMSGSEK
• Gene ID - Mouse: ENSMUSG00000029617
• Gene ID - Rat: ENSRNOG00000001032
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCZ1 pAb (ATL-HPA045114) – 1 Found

Kvainickas, Arunas; Nägele, Heike; Qi, Wenjing; Dokládal, Ladislav; Jimenez-Orgaz, Ana; Stehl, Luca; Gangurde, Dipak; Zhao, Qian; Hu, Zehan; Dengjel, Jörn; De Virgilio, Claudio; Baumeister, Ralf; Steinberg, Florian. Retromer and TBC1D5 maintain late endosomal RAB7 domains to enable amino acid-induced mTORC1 signaling. The Journal Of Cell Biology. 2019;218(9):3019-3038.