Anti CCR3 pAb (ATL-HPA069514)
Atlas Antibodies
- SKU:
- ATL-HPA069514-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CCR3
Alternative Gene Name: CC-CKR-3, CD193, CKR3, CMKBR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035448: 47%, ENSRNOG00000006736: 44%
Entrez Gene ID: 1232
Uniprot ID: P51677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI |
Gene Sequence | YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI |
Gene ID - Mouse | ENSMUSG00000035448 |
Gene ID - Rat | ENSRNOG00000006736 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCR3 pAb (ATL-HPA069514) | |
Datasheet | Anti CCR3 pAb (ATL-HPA069514) Datasheet (External Link) |
Vendor Page | Anti CCR3 pAb (ATL-HPA069514) at Atlas Antibodies |
Documents & Links for Anti CCR3 pAb (ATL-HPA069514) | |
Datasheet | Anti CCR3 pAb (ATL-HPA069514) Datasheet (External Link) |
Vendor Page | Anti CCR3 pAb (ATL-HPA069514) |