Anti CCR3 pAb (ATL-HPA069514)

Atlas Antibodies

SKU: ATL-HPA069514-25

• 

Protein Description: C-C motif chemokine receptor 3
Gene Name: CCR3
Alternative Gene Name: CC-CKR-3, CD193, CKR3, CMKBR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035448: 47%, ENSRNOG00000006736: 44%
Entrez Gene ID: 1232
Uniprot ID: P51677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI
• Gene Sequence: YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI
• Gene ID - Mouse: ENSMUSG00000035448
• Gene ID - Rat: ENSRNOG00000006736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.