Anti CCNYL1 pAb (ATL-HPA046825)

Atlas Antibodies

SKU:
ATL-HPA046825-25
  • Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cyclin Y-like 1
Gene Name: CCNYL1
Alternative Gene Name: FLJ40432
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070871: 77%, ENSRNOG00000023807: 77%
Entrez Gene ID: 151195
Uniprot ID: Q8N7R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSAELYCASDIYEAVSGDAVAVAPAVVEPAELDFGEGEGHHLQHISDREMPEDLALES
Gene Sequence GSAELYCASDIYEAVSGDAVAVAPAVVEPAELDFGEGEGHHLQHISDREMPEDLALES
Gene ID - Mouse ENSMUSG00000070871
Gene ID - Rat ENSRNOG00000023807
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCNYL1 pAb (ATL-HPA046825)
Datasheet Anti CCNYL1 pAb (ATL-HPA046825) Datasheet (External Link)
Vendor Page Anti CCNYL1 pAb (ATL-HPA046825) at Atlas Antibodies

Documents & Links for Anti CCNYL1 pAb (ATL-HPA046825)
Datasheet Anti CCNYL1 pAb (ATL-HPA046825) Datasheet (External Link)
Vendor Page Anti CCNYL1 pAb (ATL-HPA046825)