Anti CCNL2 pAb (ATL-HPA053137)

Atlas Antibodies

SKU: ATL-HPA053137-25

• 
• 

Protein Description: cyclin L2
Gene Name: CCNL2
Alternative Gene Name: ania-6b, CCNM, CCNS, HLA-ISO, PCEE, SB138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029068: 96%, ENSRNOG00000018691: 96%
Entrez Gene ID: 81669
Uniprot ID: Q96S94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
• Gene Sequence: DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
• Gene ID - Mouse: ENSMUSG00000029068
• Gene ID - Rat: ENSRNOG00000018691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.