Anti CCNI2 pAb (ATL-HPA056288)

Atlas Antibodies

SKU: ATL-HPA056288-25

• 
• 

Protein Description: cyclin I family, member 2
Gene Name: CCNI2
Alternative Gene Name: FLJ16793
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063015: 45%, ENSRNOG00000002125: 46%
Entrez Gene ID: 645121
Uniprot ID: Q6ZMN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LELLPQRNPSLHVASLTRQLQHCMAGHQLLQFKGSTLALVIITLELERLMPGWCAPISDLLKKAQVGDMQYSCCKELVMQQLRSLQSSSCTDNFVSPAN
• Gene Sequence: LELLPQRNPSLHVASLTRQLQHCMAGHQLLQFKGSTLALVIITLELERLMPGWCAPISDLLKKAQVGDMQYSCCKELVMQQLRSLQSSSCTDNFVSPAN
• Gene ID - Mouse: ENSMUSG00000063015
• Gene ID - Rat: ENSRNOG00000002125
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.