Protein Description: cyclin C
Gene Name: CCNC
Alternative Gene Name: CycC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028252: 100%, ENSRNOG00000007719: 100%
Entrez Gene ID: 892
Uniprot ID: P24863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCNC
Alternative Gene Name: CycC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028252: 100%, ENSRNOG00000007719: 100%
Entrez Gene ID: 892
Uniprot ID: P24863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGE |
| Documents & Links for Anti CCNC pAb (ATL-HPA069322) | |
| Datasheet | Anti CCNC pAb (ATL-HPA069322) Datasheet (External Link) |
| Vendor Page | Anti CCNC pAb (ATL-HPA069322) at Atlas |
| Documents & Links for Anti CCNC pAb (ATL-HPA069322) | |
| Datasheet | Anti CCNC pAb (ATL-HPA069322) Datasheet (External Link) |
| Vendor Page | Anti CCNC pAb (ATL-HPA069322) |