Protein Description: cerebral cavernous malformation 2-like
Gene Name: CCM2L
Alternative Gene Name: C20orf160, dJ310O13.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027474: 35%, ENSRNOG00000009191: 34%
Entrez Gene ID: 140706
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCM2L
Alternative Gene Name: C20orf160, dJ310O13.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027474: 35%, ENSRNOG00000009191: 34%
Entrez Gene ID: 140706
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LICQVFQIIYGDQSIECVDRAGYHYTSTPERPWLCSRSESCHTDGTYAYDADFSCCSSFNGSQDTFEACYSGTSTPSFHGSHCSGSDHSSLGLEQ |
Documents & Links for Anti CCM2L pAb (ATL-HPA071063) | |
Datasheet | Anti CCM2L pAb (ATL-HPA071063) Datasheet (External Link) |
Vendor Page | Anti CCM2L pAb (ATL-HPA071063) at Atlas |
Documents & Links for Anti CCM2L pAb (ATL-HPA071063) | |
Datasheet | Anti CCM2L pAb (ATL-HPA071063) Datasheet (External Link) |
Vendor Page | Anti CCM2L pAb (ATL-HPA071063) |