Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051210-25

• 
• 

Protein Description: chemokine (C-C motif) ligand 21
Gene Name: CCL21
Alternative Gene Name: 6Ckine, CKb9, ECL, exodus-2, SCYA21, SLC, TCA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096271: 65%, ENSRNOG00000034290: 60%
Entrez Gene ID: 6366
Uniprot ID: O00585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT
• Gene Sequence: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT
• Gene ID - Mouse: ENSMUSG00000096271
• Gene ID - Rat: ENSRNOG00000034290
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) – 4 Found

Sand, Laurens G L; Berghuis, Dagmar; Szuhai, Karoly; Hogendoorn, Pancras C W. Expression of CCL21 in Ewing sarcoma shows an inverse correlation with metastases and is a candidate target for immunotherapy. Cancer Immunology, Immunotherapy : Cii. 2016;65(8):995-1002. 

Andersson, Sandra; Nilsson, Kenneth; Fagerberg, Linn; Hallström, Björn M; Sundström, Christer; Danielsson, Angelika; Edlund, Karolina; Uhlen, Mathias; Asplund, Anna. The transcriptomic and proteomic landscapes of bone marrow and secondary lymphoid tissues. Plos One. 9(12):e115911. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Hale, Laura P; Cheatham, Lynn; Macintyre, Andrew N; LaFleur, Bonnie; Sanders, Brittany; Troy, Jesse; Kurtzberg, Joanne; Sempowski, Gregory D. T cell-depleted cultured pediatric thymus tissue as a model for some aspects of human age-related thymus involution. Geroscience. 2021;43(3):1369-1382.