Anti CCL1 pAb (ATL-HPA049861)
Atlas Antibodies
- SKU:
- ATL-HPA049861-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CCL1
Alternative Gene Name: I-309, P500, SCYA1, SISe, TCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020702: 36%, ENSRNOG00000001444: 37%
Entrez Gene ID: 6346
Uniprot ID: P22362
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS |
| Gene Sequence | RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS |
| Gene ID - Mouse | ENSMUSG00000020702 |
| Gene ID - Rat | ENSRNOG00000001444 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCL1 pAb (ATL-HPA049861) | |
| Datasheet | Anti CCL1 pAb (ATL-HPA049861) Datasheet (External Link) |
| Vendor Page | Anti CCL1 pAb (ATL-HPA049861) at Atlas Antibodies |
| Documents & Links for Anti CCL1 pAb (ATL-HPA049861) | |
| Datasheet | Anti CCL1 pAb (ATL-HPA049861) Datasheet (External Link) |
| Vendor Page | Anti CCL1 pAb (ATL-HPA049861) |
| Citations for Anti CCL1 pAb (ATL-HPA049861) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |