Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045624-25
  • Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CCDC9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414450).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 9
Gene Name: CCDC9
Alternative Gene Name: DKFZP586M1019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041375: 86%, ENSRNOG00000048848: 88%
Entrez Gene ID: 26093
Uniprot ID: Q9Y3X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEEDRKKAELEGVAVTAPRKGRSVEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWE
Gene Sequence IEEDRKKAELEGVAVTAPRKGRSVEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWE
Gene ID - Mouse ENSMUSG00000041375
Gene ID - Rat ENSRNOG00000048848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation)
Datasheet Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation)
Datasheet Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation)