Anti CCDC85C pAb (ATL-HPA058346)
Atlas Antibodies
- SKU:
- ATL-HPA058346-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCDC85C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084883: 95%, ENSRNOG00000051719: 95%
Entrez Gene ID: 317762
Uniprot ID: A6NKD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWR |
Gene Sequence | PSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWR |
Gene ID - Mouse | ENSMUSG00000084883 |
Gene ID - Rat | ENSRNOG00000051719 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC85C pAb (ATL-HPA058346) | |
Datasheet | Anti CCDC85C pAb (ATL-HPA058346) Datasheet (External Link) |
Vendor Page | Anti CCDC85C pAb (ATL-HPA058346) at Atlas Antibodies |
Documents & Links for Anti CCDC85C pAb (ATL-HPA058346) | |
Datasheet | Anti CCDC85C pAb (ATL-HPA058346) Datasheet (External Link) |
Vendor Page | Anti CCDC85C pAb (ATL-HPA058346) |