Anti CCDC85B pAb (ATL-HPA054415)
Atlas Antibodies
- SKU:
- ATL-HPA054415-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCDC85B
Alternative Gene Name: DIPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095098: 100%, ENSRNOG00000061046: 38%
Entrez Gene ID: 11007
Uniprot ID: Q15834
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRE |
Gene Sequence | ARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRE |
Gene ID - Mouse | ENSMUSG00000095098 |
Gene ID - Rat | ENSRNOG00000061046 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC85B pAb (ATL-HPA054415) | |
Datasheet | Anti CCDC85B pAb (ATL-HPA054415) Datasheet (External Link) |
Vendor Page | Anti CCDC85B pAb (ATL-HPA054415) at Atlas Antibodies |
Documents & Links for Anti CCDC85B pAb (ATL-HPA054415) | |
Datasheet | Anti CCDC85B pAb (ATL-HPA054415) Datasheet (External Link) |
Vendor Page | Anti CCDC85B pAb (ATL-HPA054415) |