Anti CCDC69 pAb (ATL-HPA052896)

Atlas Antibodies

SKU: ATL-HPA052896-25

• 
• 

Protein Description: coiled-coil domain containing 69
Gene Name: CCDC69
Alternative Gene Name: DKFZP434C171, FLJ13705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019892: 30%, ENSRNOG00000018524: 30%
Entrez Gene ID: 26112
Uniprot ID: A6NI79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRA
• Gene Sequence: EPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRA
• Gene ID - Mouse: ENSMUSG00000019892
• Gene ID - Rat: ENSRNOG00000018524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.