Anti CCDC68 pAb (ATL-HPA048197 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048197-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CCDC68 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY428372).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 68
Gene Name: CCDC68
Alternative Gene Name: SE57-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038903: 58%, ENSRNOG00000021381: 57%
Entrez Gene ID: 80323
Uniprot ID: Q9H2F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPS
Gene Sequence MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPS
Gene ID - Mouse ENSMUSG00000038903
Gene ID - Rat ENSRNOG00000021381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CCDC68 pAb (ATL-HPA048197 w/enhanced validation)
Datasheet Anti CCDC68 pAb (ATL-HPA048197 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC68 pAb (ATL-HPA048197 w/enhanced validation)