Anti CCDC66 pAb (ATL-HPA051937)

Atlas Antibodies

SKU:
ATL-HPA051937-25
  • Immunohistochemical staining of human pituitary gland shows moderate cytoplasmic positivity in anterior pituitary cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 66
Gene Name: CCDC66
Alternative Gene Name: DKFZp686C0433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046753: 52%, ENSRNOG00000028380: 52%
Entrez Gene ID: 285331
Uniprot ID: A2RUB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKGHDTSRLIKNLGVDTIQMEYNASNISNSRHDSDEISGKMNTYMNSTTSKKDTGVQTDDLNIGIFTNAESHCGSLMERDITNCSSPEISAELI
Gene Sequence QKGHDTSRLIKNLGVDTIQMEYNASNISNSRHDSDEISGKMNTYMNSTTSKKDTGVQTDDLNIGIFTNAESHCGSLMERDITNCSSPEISAELI
Gene ID - Mouse ENSMUSG00000046753
Gene ID - Rat ENSRNOG00000028380
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC66 pAb (ATL-HPA051937)
Datasheet Anti CCDC66 pAb (ATL-HPA051937) Datasheet (External Link)
Vendor Page Anti CCDC66 pAb (ATL-HPA051937) at Atlas Antibodies

Documents & Links for Anti CCDC66 pAb (ATL-HPA051937)
Datasheet Anti CCDC66 pAb (ATL-HPA051937) Datasheet (External Link)
Vendor Page Anti CCDC66 pAb (ATL-HPA051937)