Anti CCDC58 pAb (ATL-HPA047777 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047777-25

• 

Protein Description: coiled-coil domain containing 58
Gene Name: CCDC58
Alternative Gene Name: FLJ33273
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075229: 97%, ENSRNOG00000031653: 99%
Entrez Gene ID: 131076
Uniprot ID: Q4VC31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRVI
• Gene Sequence: PSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRVI
• Gene ID - Mouse: ENSMUSG00000075229
• Gene ID - Rat: ENSRNOG00000031653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.