Anti CCDC28A pAb (ATL-HPA055125)

Atlas Antibodies

SKU:
ATL-HPA055125-25
  • Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 28A
Gene Name: CCDC28A
Alternative Gene Name: C6orf80, CCRL1AP, DKFZp586D0623
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059554: 93%, ENSRNOG00000053347: 88%
Entrez Gene ID: 25901
Uniprot ID: Q8IWP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSA
Gene Sequence LARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSA
Gene ID - Mouse ENSMUSG00000059554
Gene ID - Rat ENSRNOG00000053347
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC28A pAb (ATL-HPA055125)
Datasheet Anti CCDC28A pAb (ATL-HPA055125) Datasheet (External Link)
Vendor Page Anti CCDC28A pAb (ATL-HPA055125) at Atlas Antibodies

Documents & Links for Anti CCDC28A pAb (ATL-HPA055125)
Datasheet Anti CCDC28A pAb (ATL-HPA055125) Datasheet (External Link)
Vendor Page Anti CCDC28A pAb (ATL-HPA055125)