Anti CCDC191 pAb (ATL-HPA047833)

Atlas Antibodies

SKU:
ATL-HPA047833-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 191
Gene Name: CCDC191
Alternative Gene Name: KIAA1407
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022701: 82%, ENSRNOG00000057815: 79%
Entrez Gene ID: 57577
Uniprot ID: Q8NCU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVMFQSTHILPDEEKMVKERKRKLKEVLIQTFKENQQCQKRYFAAWHKLILDHRIKLGKAGTLSDWKIQLKVLRAWRDYTRFQKLERETQ
Gene Sequence KVMFQSTHILPDEEKMVKERKRKLKEVLIQTFKENQQCQKRYFAAWHKLILDHRIKLGKAGTLSDWKIQLKVLRAWRDYTRFQKLERETQ
Gene ID - Mouse ENSMUSG00000022701
Gene ID - Rat ENSRNOG00000057815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC191 pAb (ATL-HPA047833)
Datasheet Anti CCDC191 pAb (ATL-HPA047833) Datasheet (External Link)
Vendor Page Anti CCDC191 pAb (ATL-HPA047833) at Atlas Antibodies

Documents & Links for Anti CCDC191 pAb (ATL-HPA047833)
Datasheet Anti CCDC191 pAb (ATL-HPA047833) Datasheet (External Link)
Vendor Page Anti CCDC191 pAb (ATL-HPA047833)