Anti CCDC189 pAb (ATL-HPA046289)

Atlas Antibodies

SKU: ATL-HPA046289-25

• 
• 

Protein Description: coiled-coil domain containing 189
Gene Name: CCDC189
Alternative Gene Name: C16orf93, MGC104706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057176: 60%, ENSRNOG00000053015: 58%
Entrez Gene ID: 90835
Uniprot ID: A1A4V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESETEKEESKEMEEQAVTPQKEELETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKLTALERPFQLPPG
• Gene Sequence: ESETEKEESKEMEEQAVTPQKEELETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKLTALERPFQLPPG
• Gene ID - Mouse: ENSMUSG00000057176
• Gene ID - Rat: ENSRNOG00000053015
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.