Anti CCDC188 pAb (ATL-HPA049901)

Atlas Antibodies

SKU:
ATL-HPA049901-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 188
Gene Name: CCDC188
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111372: 58%, ENSRNOG00000042711: 53%
Entrez Gene ID: 388849
Uniprot ID: H7C350
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFLSSQEQRARDTEGPRQGDLEAGLGWGWPLHPGSNQGAPRQGGSIGSGTRPCPCPPLSREGGALASPRVALSQLQCGLLGSAEQS
Gene Sequence LFLSSQEQRARDTEGPRQGDLEAGLGWGWPLHPGSNQGAPRQGGSIGSGTRPCPCPPLSREGGALASPRVALSQLQCGLLGSAEQS
Gene ID - Mouse ENSMUSG00000111372
Gene ID - Rat ENSRNOG00000042711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC188 pAb (ATL-HPA049901)
Datasheet Anti CCDC188 pAb (ATL-HPA049901) Datasheet (External Link)
Vendor Page Anti CCDC188 pAb (ATL-HPA049901) at Atlas Antibodies

Documents & Links for Anti CCDC188 pAb (ATL-HPA049901)
Datasheet Anti CCDC188 pAb (ATL-HPA049901) Datasheet (External Link)
Vendor Page Anti CCDC188 pAb (ATL-HPA049901)