Anti CCDC151 pAb (ATL-HPA054626 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054626-25

• 

Protein Description: coiled-coil domain containing 151
Gene Name: CCDC151
Alternative Gene Name: MGC20983
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039632: 73%, ENSRNOG00000013263: 76%
Entrez Gene ID: 115948
Uniprot ID: A5D8V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLDLLKGDEKVVQAVIREWKWEKPYLKNRTGQALEHLDHRLREKVKQQNALRHQVVLRQRRLEELQLQHSLRLLEMAEAQNRHTEVAKTMRNLE
• Gene Sequence: LLDLLKGDEKVVQAVIREWKWEKPYLKNRTGQALEHLDHRLREKVKQQNALRHQVVLRQRRLEELQLQHSLRLLEMAEAQNRHTEVAKTMRNLE
• Gene ID - Mouse: ENSMUSG00000039632
• Gene ID - Rat: ENSRNOG00000013263
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.