Anti CCDC150 pAb (ATL-HPA048104)

Atlas Antibodies

SKU:
ATL-HPA048104-25
  • Immunohistochemical staining of human testis shows cytoplasmic positivity in cells of seminiferous ducts.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 150
Gene Name: CCDC150
Alternative Gene Name: FLJ39660
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025983: 83%, ENSRNOG00000013318: 82%
Entrez Gene ID: 284992
Uniprot ID: Q8NCX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KARIIADHQAILQVEQKMMTQTFQEQNLLLDAAHASITNELQTVQNEKTQLQAHLDHLILEHNQCIQKAQDAEKRTAVQKELLESTIARLRGELE
Gene Sequence KARIIADHQAILQVEQKMMTQTFQEQNLLLDAAHASITNELQTVQNEKTQLQAHLDHLILEHNQCIQKAQDAEKRTAVQKELLESTIARLRGELE
Gene ID - Mouse ENSMUSG00000025983
Gene ID - Rat ENSRNOG00000013318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC150 pAb (ATL-HPA048104)
Datasheet Anti CCDC150 pAb (ATL-HPA048104) Datasheet (External Link)
Vendor Page Anti CCDC150 pAb (ATL-HPA048104) at Atlas Antibodies

Documents & Links for Anti CCDC150 pAb (ATL-HPA048104)
Datasheet Anti CCDC150 pAb (ATL-HPA048104) Datasheet (External Link)
Vendor Page Anti CCDC150 pAb (ATL-HPA048104)