Anti CCDC144A pAb (ATL-HPA047851)

Atlas Antibodies

SKU:
ATL-HPA047851-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 144A
Gene Name: CCDC144A
Alternative Gene Name: FLJ43983, KIAA0565
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021360: 28%, ENSRNOG00000023312: 30%
Entrez Gene ID: 9720
Uniprot ID: A2RUR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKCPSVSPSMPENQSATKELGQMNLTEREKMDTGVVLLSGNDTLHDLCQSQLPE
Gene Sequence DKCPSVSPSMPENQSATKELGQMNLTEREKMDTGVVLLSGNDTLHDLCQSQLPE
Gene ID - Mouse ENSMUSG00000021360
Gene ID - Rat ENSRNOG00000023312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC144A pAb (ATL-HPA047851)
Datasheet Anti CCDC144A pAb (ATL-HPA047851) Datasheet (External Link)
Vendor Page Anti CCDC144A pAb (ATL-HPA047851) at Atlas Antibodies

Documents & Links for Anti CCDC144A pAb (ATL-HPA047851)
Datasheet Anti CCDC144A pAb (ATL-HPA047851) Datasheet (External Link)
Vendor Page Anti CCDC144A pAb (ATL-HPA047851)