Anti CCDC137 pAb (ATL-HPA053914)

Atlas Antibodies

SKU:
ATL-HPA053914-25
  • Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 137
Gene Name: CCDC137
Alternative Gene Name: MGC16597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049957: 49%, ENSRNOG00000048712: 55%
Entrez Gene ID: 339230
Uniprot ID: Q6PK04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQ
Gene Sequence QRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQ
Gene ID - Mouse ENSMUSG00000049957
Gene ID - Rat ENSRNOG00000048712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC137 pAb (ATL-HPA053914)
Datasheet Anti CCDC137 pAb (ATL-HPA053914) Datasheet (External Link)
Vendor Page Anti CCDC137 pAb (ATL-HPA053914) at Atlas Antibodies

Documents & Links for Anti CCDC137 pAb (ATL-HPA053914)
Datasheet Anti CCDC137 pAb (ATL-HPA053914) Datasheet (External Link)
Vendor Page Anti CCDC137 pAb (ATL-HPA053914)