Anti CCDC127 pAb (ATL-HPA045052)

Atlas Antibodies

SKU:
ATL-HPA045052-25
  • Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
  • Western blot analysis in human cell line HeLa.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 127
Gene Name: CCDC127
Alternative Gene Name: FLJ25701
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021578: 83%, ENSRNOG00000012775: 82%
Entrez Gene ID: 133957
Uniprot ID: Q96BQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRTAAFQQDLEAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSAYLSCLQREENWQRR
Gene Sequence RRTAAFQQDLEAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSAYLSCLQREENWQRR
Gene ID - Mouse ENSMUSG00000021578
Gene ID - Rat ENSRNOG00000012775
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC127 pAb (ATL-HPA045052)
Datasheet Anti CCDC127 pAb (ATL-HPA045052) Datasheet (External Link)
Vendor Page Anti CCDC127 pAb (ATL-HPA045052) at Atlas Antibodies

Documents & Links for Anti CCDC127 pAb (ATL-HPA045052)
Datasheet Anti CCDC127 pAb (ATL-HPA045052) Datasheet (External Link)
Vendor Page Anti CCDC127 pAb (ATL-HPA045052)