Anti CCDC124 pAb (ATL-HPA046765)

Atlas Antibodies

SKU:
ATL-HPA046765-25
  • Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 124
Gene Name: CCDC124
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007721: 84%, ENSRNOG00000018932: 82%
Entrez Gene ID: 115098
Uniprot ID: Q96CT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLRE
Gene Sequence LEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLRE
Gene ID - Mouse ENSMUSG00000007721
Gene ID - Rat ENSRNOG00000018932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC124 pAb (ATL-HPA046765)
Datasheet Anti CCDC124 pAb (ATL-HPA046765) Datasheet (External Link)
Vendor Page Anti CCDC124 pAb (ATL-HPA046765) at Atlas Antibodies

Documents & Links for Anti CCDC124 pAb (ATL-HPA046765)
Datasheet Anti CCDC124 pAb (ATL-HPA046765) Datasheet (External Link)
Vendor Page Anti CCDC124 pAb (ATL-HPA046765)