Anti CCDC121 pAb (ATL-HPA051791)

Atlas Antibodies

SKU: ATL-HPA051791-25

• 
• 

Protein Description: coiled-coil domain containing 121
Gene Name: CCDC121
Alternative Gene Name: FLJ13646, FLJ43364
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050625: 43%, ENSRNOG00000022717: 43%
Entrez Gene ID: 79635
Uniprot ID: Q6ZUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSL
• Gene Sequence: LNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSL
• Gene ID - Mouse: ENSMUSG00000050625
• Gene ID - Rat: ENSRNOG00000022717
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.