Anti CCDC112 pAb (ATL-HPA050621)

Atlas Antibodies

SKU:
ATL-HPA050621-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 112
Gene Name: CCDC112
Alternative Gene Name: MGC39633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071855: 79%, ENSRNOG00000003559: 76%
Entrez Gene ID: 153733
Uniprot ID: Q8NEF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGCFSTSGGIRPFHLQNWKQKVNQTKKAEFVRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHS
Gene Sequence DGCFSTSGGIRPFHLQNWKQKVNQTKKAEFVRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHS
Gene ID - Mouse ENSMUSG00000071855
Gene ID - Rat ENSRNOG00000003559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC112 pAb (ATL-HPA050621)
Datasheet Anti CCDC112 pAb (ATL-HPA050621) Datasheet (External Link)
Vendor Page Anti CCDC112 pAb (ATL-HPA050621) at Atlas Antibodies

Documents & Links for Anti CCDC112 pAb (ATL-HPA050621)
Datasheet Anti CCDC112 pAb (ATL-HPA050621) Datasheet (External Link)
Vendor Page Anti CCDC112 pAb (ATL-HPA050621)