Anti CCDC112 pAb (ATL-HPA045120)

Atlas Antibodies

SKU:
ATL-HPA045120-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 112
Gene Name: CCDC112
Alternative Gene Name: MGC39633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071855: 91%, ENSRNOG00000003559: 91%
Entrez Gene ID: 153733
Uniprot ID: Q8NEF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPE
Gene Sequence NVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPE
Gene ID - Mouse ENSMUSG00000071855
Gene ID - Rat ENSRNOG00000003559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC112 pAb (ATL-HPA045120)
Datasheet Anti CCDC112 pAb (ATL-HPA045120) Datasheet (External Link)
Vendor Page Anti CCDC112 pAb (ATL-HPA045120) at Atlas Antibodies

Documents & Links for Anti CCDC112 pAb (ATL-HPA045120)
Datasheet Anti CCDC112 pAb (ATL-HPA045120) Datasheet (External Link)
Vendor Page Anti CCDC112 pAb (ATL-HPA045120)