Anti CCDC105 pAb (ATL-HPA058585)

Atlas Antibodies

SKU:
ATL-HPA058585-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 105
Gene Name: CCDC105
Alternative Gene Name: FLJ40365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078442: 79%, ENSRNOG00000007375: 79%
Entrez Gene ID: 126402
Uniprot ID: Q8IYK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKR
Gene Sequence RDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKR
Gene ID - Mouse ENSMUSG00000078442
Gene ID - Rat ENSRNOG00000007375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC105 pAb (ATL-HPA058585)
Datasheet Anti CCDC105 pAb (ATL-HPA058585) Datasheet (External Link)
Vendor Page Anti CCDC105 pAb (ATL-HPA058585) at Atlas Antibodies

Documents & Links for Anti CCDC105 pAb (ATL-HPA058585)
Datasheet Anti CCDC105 pAb (ATL-HPA058585) Datasheet (External Link)
Vendor Page Anti CCDC105 pAb (ATL-HPA058585)