Anti CCDC102B pAb (ATL-HPA048194)

Atlas Antibodies

SKU:
ATL-HPA048194-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic, nuclear and membranous positivity in cells in kidney tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 102B
Gene Name: CCDC102B
Alternative Gene Name: ACY1L, AN, C18orf14, FLJ23594, HsT1731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094870: 26%, ENSRNOG00000015925: 26%
Entrez Gene ID: 79839
Uniprot ID: Q68D86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNLDSIHRLIEETQIFQMQQSSIKSRGDMVAPASPPRDTCNTCFPLHGLQSHAAHNFCAHSYNTNKWDICEELRLRE
Gene Sequence MNLDSIHRLIEETQIFQMQQSSIKSRGDMVAPASPPRDTCNTCFPLHGLQSHAAHNFCAHSYNTNKWDICEELRLRE
Gene ID - Mouse ENSMUSG00000094870
Gene ID - Rat ENSRNOG00000015925
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC102B pAb (ATL-HPA048194)
Datasheet Anti CCDC102B pAb (ATL-HPA048194) Datasheet (External Link)
Vendor Page Anti CCDC102B pAb (ATL-HPA048194) at Atlas Antibodies

Documents & Links for Anti CCDC102B pAb (ATL-HPA048194)
Datasheet Anti CCDC102B pAb (ATL-HPA048194) Datasheet (External Link)
Vendor Page Anti CCDC102B pAb (ATL-HPA048194)