Protein Description: chibby homolog 3 (Drosophila)
Gene Name: CBY3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050087: 53%, ENSRNOG00000003395: 47%
Entrez Gene ID: 646019
Uniprot ID: A6NI87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CBY3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050087: 53%, ENSRNOG00000003395: 47%
Entrez Gene ID: 646019
Uniprot ID: A6NI87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PEVIPTAAARAGQRKMRKRAGASAGVLMIQPCALDS |
| Documents & Links for Anti CBY3 pAb (ATL-HPA069037) | |
| Datasheet | Anti CBY3 pAb (ATL-HPA069037) Datasheet (External Link) |
| Vendor Page | Anti CBY3 pAb (ATL-HPA069037) at Atlas |
| Documents & Links for Anti CBY3 pAb (ATL-HPA069037) | |
| Datasheet | Anti CBY3 pAb (ATL-HPA069037) Datasheet (External Link) |
| Vendor Page | Anti CBY3 pAb (ATL-HPA069037) |