Anti CBX7 pAb (ATL-HPA048677)

Atlas Antibodies

SKU:
ATL-HPA048677-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromobox homolog 7
Gene Name: CBX7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053411: 85%, ENSRNOG00000016875: 88%
Entrez Gene ID: 23492
Uniprot ID: O95931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Gene Sequence ADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Gene ID - Mouse ENSMUSG00000053411
Gene ID - Rat ENSRNOG00000016875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CBX7 pAb (ATL-HPA048677)
Datasheet Anti CBX7 pAb (ATL-HPA048677) Datasheet (External Link)
Vendor Page Anti CBX7 pAb (ATL-HPA048677) at Atlas Antibodies

Documents & Links for Anti CBX7 pAb (ATL-HPA048677)
Datasheet Anti CBX7 pAb (ATL-HPA048677) Datasheet (External Link)
Vendor Page Anti CBX7 pAb (ATL-HPA048677)