Anti CBX6 pAb (ATL-HPA048653)

Atlas Antibodies

SKU:
ATL-HPA048653-25
  • Immunohistochemical staining of human stomach, lower shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromobox homolog 6
Gene Name: CBX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089715: 100%, ENSRNOG00000046955: 91%
Entrez Gene ID: 23466
Uniprot ID: O95503
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVID
Gene Sequence ISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVID
Gene ID - Mouse ENSMUSG00000089715
Gene ID - Rat ENSRNOG00000046955
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CBX6 pAb (ATL-HPA048653)
Datasheet Anti CBX6 pAb (ATL-HPA048653) Datasheet (External Link)
Vendor Page Anti CBX6 pAb (ATL-HPA048653) at Atlas Antibodies

Documents & Links for Anti CBX6 pAb (ATL-HPA048653)
Datasheet Anti CBX6 pAb (ATL-HPA048653) Datasheet (External Link)
Vendor Page Anti CBX6 pAb (ATL-HPA048653)