Anti CAT pAb (ATL-HPA051282 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051282-25

• 
• 

Protein Description: catalase
Gene Name: CAT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027187: 86%, ENSRNOG00000008364: 89%
Entrez Gene ID: 847
Uniprot ID: P04040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE
• Gene Sequence: ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE
• Gene ID - Mouse: ENSMUSG00000027187
• Gene ID - Rat: ENSRNOG00000008364
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CAT pAb (ATL-HPA051282 w/enhanced validation) – 1 Found

Ma, Xi; Zhou, Lin; Zheng, Shusen. Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma. Peerj. 8( 32296612):e8930.