Anti CASR pAb (ATL-HPA050335 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050335-100

• 
• 

Protein Description: calcium-sensing receptor
Gene Name: CASR
Alternative Gene Name: FHH, GPRC2A, HHC, HHC1, NSHPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051980: 98%, ENSRNOG00000002265: 98%
Entrez Gene ID: 846
Uniprot ID: P41180
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI
• Gene Sequence: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI
• Gene ID - Mouse: ENSMUSG00000051980
• Gene ID - Rat: ENSRNOG00000002265
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.