Anti CASP2 pAb (ATL-HPA050678)

Atlas Antibodies

SKU: ATL-HPA050678-25

• 
• 

Protein Description: caspase 2, apoptosis-related cysteine peptidase
Gene Name: CASP2
Alternative Gene Name: ICH1, MGC2181, NEDD2, PPP1R57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029863: 87%, ENSRNOG00000016707: 86%
Entrez Gene ID: 835
Uniprot ID: P42575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTG
• Gene Sequence: VELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTG
• Gene ID - Mouse: ENSMUSG00000029863
• Gene ID - Rat: ENSRNOG00000016707
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.