Protein Description: CASK interacting protein 2
Gene Name: CASKIN2
Alternative Gene Name: ANKS5B, FLJ21609, KIAA1139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034471: 87%, ENSRNOG00000004310: 85%
Entrez Gene ID: 57513
Uniprot ID: Q8WXE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CASKIN2
Alternative Gene Name: ANKS5B, FLJ21609, KIAA1139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034471: 87%, ENSRNOG00000004310: 85%
Entrez Gene ID: 57513
Uniprot ID: Q8WXE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR |
Documents & Links for Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation) | |
Datasheet | Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation) at Atlas |
Documents & Links for Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation) | |
Datasheet | Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation) |