Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA071906-25
  • Immunohistochemistry analysis in human spleen and tonsil tissues using Anti-CASKIN2 antibody. Corresponding CASKIN2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CASK interacting protein 2
Gene Name: CASKIN2
Alternative Gene Name: ANKS5B, FLJ21609, KIAA1139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034471: 87%, ENSRNOG00000004310: 85%
Entrez Gene ID: 57513
Uniprot ID: Q8WXE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR
Gene Sequence APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR
Gene ID - Mouse ENSMUSG00000034471
Gene ID - Rat ENSRNOG00000004310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation)
Datasheet Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CASKIN2 pAb (ATL-HPA071906 w/enhanced validation)