Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049488-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CASC4
Alternative Gene Name: DKFZp459F1927, H63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060227: 83%, ENSRNOG00000016357: 82%
Entrez Gene ID: 113201
Uniprot ID: Q6P4E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG |
Gene Sequence | DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG |
Gene ID - Mouse | ENSMUSG00000060227 |
Gene ID - Rat | ENSRNOG00000016357 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) | |
Datasheet | Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) | |
Datasheet | Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) |
Citations for Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) – 1 Found |
van Bommel, Danique M; Toonen, Ruud F; Verhage, Matthijs. Mapping localization of 21 endogenous proteins in the Golgi apparatus of rodent neurons. Scientific Reports. 2023;13(1):2871. PubMed |