Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050530-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CAP2 antibody. Corresponding CAP2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CAP, adenylate cyclase-associated protein, 2 (yeast)
Gene Name: CAP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021373: 88%, ENSRNOG00000043350: 85%
Entrez Gene ID: 10486
Uniprot ID: P40123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPT
Gene Sequence PLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPT
Gene ID - Mouse ENSMUSG00000021373
Gene ID - Rat ENSRNOG00000043350
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation)
Datasheet Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation)
Datasheet Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation)