Anti CALML4 pAb (ATL-HPA051109 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051109-25

• 
• 

Protein Description: calmodulin-like 4
Gene Name: CALML4
Alternative Gene Name: MGC4809, NY-BR-20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032246: 81%, ENSRNOG00000038202: 81%
Entrez Gene ID: 91860
Uniprot ID: Q96GE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY
• Gene Sequence: LLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY
• Gene ID - Mouse: ENSMUSG00000032246
• Gene ID - Rat: ENSRNOG00000038202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.