Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)

Atlas Antibodies

  • Immunohistochemistry analysis in human thyroid gland and duodenum tissues using Anti-CALCA antibody. Corresponding CALCA RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$486.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Adding to cart… The item has been added
Protein Description: calcitonin related polypeptide alpha
Gene Name: CALCA
Alternative Gene Name: CALC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030669: 78%, ENSRNOG00000011130: 81%
Entrez Gene ID: 796
Uniprot ID: P01258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS
Gene Sequence SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS
Gene ID - Mouse ENSMUSG00000030669
Gene ID - Rat ENSRNOG00000011130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)
Datasheet Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)
Datasheet Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)



!