Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)
Atlas Antibodies
- Shipping:
- Calculated at Checkout
$486.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Gene Name: CALCA
Alternative Gene Name: CALC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030669: 78%, ENSRNOG00000011130: 81%
Entrez Gene ID: 796
Uniprot ID: P01258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS |
Gene Sequence | SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS |
Gene ID - Mouse | ENSMUSG00000030669 |
Gene ID - Rat | ENSRNOG00000011130 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) | |
Datasheet | Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) | |
Datasheet | Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) |