Anti CACNA1S pAb (ATL-HPA048892 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048892-25

• 

Protein Description: calcium channel, voltage-dependent, L type, alpha 1S subunit
Gene Name: CACNA1S
Alternative Gene Name: CACNL1A3, Cav1.1, HOKPP, hypoPP, MHS5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026407: 70%, ENSRNOG00000046231: 67%
Entrez Gene ID: 779
Uniprot ID: Q13698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSSVHYEREFPEETETPATRGRALGQPCRVLGPHSKPCVE
• Gene Sequence: ESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSSVHYEREFPEETETPATRGRALGQPCRVLGPHSKPCVE
• Gene ID - Mouse: ENSMUSG00000026407
• Gene ID - Rat: ENSRNOG00000046231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.