Anti CABYR pAb (ATL-HPA047801 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047801-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-CABYR antibody. Corresponding CABYR RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium binding tyrosine-(Y)-phosphorylation regulated
Gene Name: CABYR
Alternative Gene Name: CBP86, CT88, FSP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024430: 58%, ENSRNOG00000047436: 56%
Entrez Gene ID: 26256
Uniprot ID: O75952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD
Gene Sequence YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD
Gene ID - Mouse ENSMUSG00000024430
Gene ID - Rat ENSRNOG00000047436
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CABYR pAb (ATL-HPA047801 w/enhanced validation)
Datasheet Anti CABYR pAb (ATL-HPA047801 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CABYR pAb (ATL-HPA047801 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CABYR pAb (ATL-HPA047801 w/enhanced validation)
Datasheet Anti CABYR pAb (ATL-HPA047801 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CABYR pAb (ATL-HPA047801 w/enhanced validation)