Anti CABLES2 pAb (ATL-HPA052138)

Atlas Antibodies

SKU: ATL-HPA052138-25

• 

Protein Description: Cdk5 and Abl enzyme substrate 2
Gene Name: CABLES2
Alternative Gene Name: C20orf150, dJ908M14.2, ik3-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038990: 81%, ENSRNOG00000051420: 83%
Entrez Gene ID: 81928
Uniprot ID: Q9BTV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
• Gene Sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
• Gene ID - Mouse: ENSMUSG00000038990
• Gene ID - Rat: ENSRNOG00000051420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.