Protein Description: calcium binding protein 39 like
Gene Name: CAB39L
Alternative Gene Name: bA103J18.3, FLJ12577, MO2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021981: 100%, ENSRNOG00000011603: 100%
Entrez Gene ID: 81617
Uniprot ID: Q9H9S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAB39L
Alternative Gene Name: bA103J18.3, FLJ12577, MO2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021981: 100%, ENSRNOG00000011603: 100%
Entrez Gene ID: 81617
Uniprot ID: Q9H9S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVA |
| Documents & Links for Anti CAB39L pAb (ATL-HPA076632) | |
| Datasheet | Anti CAB39L pAb (ATL-HPA076632) Datasheet (External Link) |
| Vendor Page | Anti CAB39L pAb (ATL-HPA076632) at Atlas |
| Documents & Links for Anti CAB39L pAb (ATL-HPA076632) | |
| Datasheet | Anti CAB39L pAb (ATL-HPA076632) Datasheet (External Link) |
| Vendor Page | Anti CAB39L pAb (ATL-HPA076632) |