Anti CAB39L pAb (ATL-HPA076632)

Atlas Antibodies

SKU:
ATL-HPA076632-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium binding protein 39 like
Gene Name: CAB39L
Alternative Gene Name: bA103J18.3, FLJ12577, MO2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021981: 100%, ENSRNOG00000011603: 100%
Entrez Gene ID: 81617
Uniprot ID: Q9H9S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVA
Gene Sequence IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVA
Gene ID - Mouse ENSMUSG00000021981
Gene ID - Rat ENSRNOG00000011603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAB39L pAb (ATL-HPA076632)
Datasheet Anti CAB39L pAb (ATL-HPA076632) Datasheet (External Link)
Vendor Page Anti CAB39L pAb (ATL-HPA076632) at Atlas Antibodies

Documents & Links for Anti CAB39L pAb (ATL-HPA076632)
Datasheet Anti CAB39L pAb (ATL-HPA076632) Datasheet (External Link)
Vendor Page Anti CAB39L pAb (ATL-HPA076632)