Anti CA10 pAb (ATL-HPA054825)

Atlas Antibodies

SKU: ATL-HPA054825-25

• 

Protein Description: carbonic anhydrase X
Gene Name: CA10
Alternative Gene Name: CA-RPX, CARPX, HUCEP-15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056158: 100%, ENSRNOG00000002626: 100%
Entrez Gene ID: 56934
Uniprot ID: Q9NS85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR
• Gene Sequence: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR
• Gene ID - Mouse: ENSMUSG00000056158
• Gene ID - Rat: ENSRNOG00000002626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CA10 pAb (ATL-HPA054825) – 2 Found

Sterky, Fredrik H; Trotter, Justin H; Lee, Sung-Jin; Recktenwald, Christian V; Du, Xiao; Zhou, Bo; Zhou, Peng; Schwenk, Jochen; Fakler, Bernd; Südhof, Thomas C. Carbonic anhydrase-related protein CA10 is an evolutionarily conserved pan-neurexin ligand. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(7):E1253-E1262. 

Montoliu-Gaya, Laia; Tietze, Daniel; Kaminski, Debora; Mirgorodskaya, Ekaterina; Tietze, Alesia A; Sterky, Fredrik H. CA10 regulates neurexin heparan sulfate addition via a direct binding in the secretory pathway. Embo Reports. 2021;22(4):e51349.