Anti C9orf64 pAb (ATL-HPA054903)

Atlas Antibodies

SKU: ATL-HPA054903-25

• 

Protein Description: chromosome 9 open reading frame 64
Gene Name: C9orf64
Alternative Gene Name: MGC10999
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021550: 79%, ENSRNOG00000019232: 82%
Entrez Gene ID: 84267
Uniprot ID: Q5T6V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGS
• Gene Sequence: QDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGS
• Gene ID - Mouse: ENSMUSG00000021550
• Gene ID - Rat: ENSRNOG00000019232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.