Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053008-25

• 

Protein Description: chromosome 9 open reading frame 24
Gene Name: C9orf24
Alternative Gene Name: bA573M23.4, CBE1, MGC32921, MGC33614, NYD-SP22, SMRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028441: 66%, ENSRNOG00000013320: 67%
Entrez Gene ID: 84688
Uniprot ID: Q8NCR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLN
• Gene Sequence: KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLN
• Gene ID - Mouse: ENSMUSG00000028441
• Gene ID - Rat: ENSRNOG00000013320
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) – 1 Found

Amani, Vladimir; Donson, Andrew M; Lummus, Seth C; Prince, Eric W; Griesinger, Andrea M; Witt, Davis A; Hankinson, Todd C; Handler, Michael H; Dorris, Kathleen; Vibhakar, Rajeev; Foreman, Nicholas K; Hoffman, Lindsey M. Characterization of 2 Novel Ependymoma Cell Lines With Chromosome 1q Gain Derived From Posterior Fossa Tumors of Childhood. Journal Of Neuropathology And Experimental Neurology. 2017;76(7):595-604.