Anti C9orf152 pAb (ATL-HPA050769)

Atlas Antibodies

SKU:
ATL-HPA050769-25
  • Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 152
Gene Name: C9orf152
Alternative Gene Name: bA470J20.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052117: 49%, ENSRNOG00000012068: 49%
Entrez Gene ID: 401546
Uniprot ID: Q5JTZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNL
Gene Sequence PQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNL
Gene ID - Mouse ENSMUSG00000052117
Gene ID - Rat ENSRNOG00000012068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C9orf152 pAb (ATL-HPA050769)
Datasheet Anti C9orf152 pAb (ATL-HPA050769) Datasheet (External Link)
Vendor Page Anti C9orf152 pAb (ATL-HPA050769) at Atlas Antibodies

Documents & Links for Anti C9orf152 pAb (ATL-HPA050769)
Datasheet Anti C9orf152 pAb (ATL-HPA050769) Datasheet (External Link)
Vendor Page Anti C9orf152 pAb (ATL-HPA050769)